SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001256334.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001256334.1.50509
Domain Number 1 Region: 152-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-40
Family Nuclear receptor ligand-binding domain 0.00074
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-29
Family Nuclear receptor 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001256334.1.50509
Sequence length 385
Comment Nuclear Hormone Receptor family [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MENKEVCLVCQDFSSGYHYGIPSCNGCKTFFRRTVMKKQKFVCQFDQNCPVDKSIRCACR
FCRFEKCLKVGMDKTSLQASRDPIGYTKRNKKTLRHPMNELSGDESNSCTPDRQLSPLRS
FENSLNFLAVRERSANELRMSSYLPKRSLKQALCSKPLINDPIFMSKHATVSPRHTFEKL
RFITQDDYHYWHERDWFVLTEYAKTFKVFKNMPYHDKTELVCHAAIVIPVLNQVYNSPDY
GLDTVVFPDGTYYDRTHEPTRPAGLNRKKYQVLDLVLKPFREMEINFNEFAAFKAITFLN
PDADISLESKHAINEERVLITKQLYAYMVQKDGLEKAIYRFGRLILMGTSMSKMACESKE
AVWIADFFENIGFTSFAKELIFGDH
Download sequence
Identical sequences Q9XXM8
H12C20.3 H12C20.3a.1 H12C20.3a.2 NP_001256334.1.50509 H12C20.3 6239.H12C20.3 H12C20.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]