SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001258184.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001258184.1.99540
Domain Number 1 Region: 66-575
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 8.24e-186
Family Myeloperoxidase-like 0.000000000000201
Further Details:      
 
Domain Number 2 Region: 25-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000475
Family EGF-type module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001258184.1.99540
Sequence length 588
Comment prostaglandin G/H synthase 1 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
maglcltvlfvivttsyslevsdkvnpccyypcqhkgvcvrfemdkylcdctrtgyygtn
ctipewwtkfreflrpspafyhyiltrfkwfwdiinstfirdvivrlvltvrsnlipspp
tynsaygyisweaysnvsyftrvlppvpddcptpmgtkgkmelpdasllvetflkrekfi
pdpqgtnllfaffaqhfthqffktygrmgrgfikgfghgvdlshiygdslerqhmlrlft
dgklkyqiingdiypptvveapvfmiypdnvpkekqfavgqevfgllpglmmyatlwlre
hnrvcdilkkehptwddeqlfqttrliligetikiviedyvqhlsgyylklkfdpellfg
vqfqyrnriavefnqlyhwhplipekfqiledeyshsrflyntsilldygvealvesftk
qiagkigggknhhpgllkvaagvieesrklrlqpfneyrkrfglkayksfkdltgeeims
aqleelygdidalefylgllleksnpnsifgesmveigapfslkglmgnpicspeywkps
tfggetgfnivktatiqklvclnvkqcpfvafhvpddvlpklkksdel
Download sequence
Identical sequences gi|301623767|gb|XP_002941183| NP_001258184.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]