SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001258804.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001258804.1.92137
Domain Number 1 Region: 41-93
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000105
Family CUE domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001258804.1.92137
Sequence length 386
Comment CUE domain-containing protein 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPN
MDYDIIECVLRANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEP
DSSDEEPPPVYSPPAYHMHVFDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGN
LPDDFLRILPQQLDSIQGNAGGPKPGSGEGCPPAMAGPGPGDQESRWKQYLEDERIALFL
QNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
DALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVE
GHACDEDFRGRRQEAPKVEEGLREGQ
Download sequence
Identical sequences Q9NWM3
NP_001258804.1.87134 NP_001258804.1.92137 NP_001278954.1.87134 NP_001278954.1.92137 XP_006721963.1.92137 9606.ENSP00000353373 ENSP00000353373 gi|8923665|ref|NP_060419.1| ENSP00000353373 ENSP00000384712 ENSP00000462717 ENSP00000353373 ENSP00000384712 ENSP00000462717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]