SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001259068.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001259068.1.81976
Domain Number 1 Region: 232-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.13e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 120-191
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 576-623
Classification Level Classification E-value
Superfamily RING/U-box 0.00000022
Family RING finger domain, C3HC4 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001259068.1.81976
Sequence length 628
Comment uncharacterized protein Dmel_CG11360, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAAQVTPKISTCINSKGSIQKKNQAQHHDMSEQSKVNESTLPLSDDPRTLQLALELSLVG
FNDNQNCYAQPAQPLPMPLSARSDFEIGTINSTLPIPSAPNCLLLPNAGAVSSEDRSKKS
QNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKA
KREILSAADHFSLIRASRKPVSDSQNNGMVGSTTSSGGGAVPRMSGPPCMPGQVTIQVRV
PYRVVGLVVGPKGATIKHIQQETQTYIVTPSREKEPIFEVTGLPDNVDTARKQIEAHIAL
RTGSGSGSGDAITMQSSDSVDTKEYASLPSLTQILNDDLNSEILSSIYKNSVPSTQEYAN
NSMKTVVNVSNSVKLVQGHHTGNCFQKSEFAEMEMTANITAADILDKRLPGNEVSVPLAK
ANVANIVFRTTSSKTLSFCPPTSTSASFHSNCNANILTRSCSSASSTTSTKSTNNSANTP
PEILNIWKSISDSIDVDEGIGDSPSIWNQPANIIPTAHCSPTISISPTDSLLGMGEHSAN
QQNLNHAKEPIMPNLPQKIKGIQVQSNADNFLTHRECFVCNENTVTTALVPCGHNMFCME
CANHICLSMDAVCPVCNSIVYHAMRILG
Download sequence
Identical sequences Q9V4F3
FBpp0088160 7227.FBpp0088160 FBpp0088160 NP_001259068.1.81976 NP_001259069.1.81976 NP_001259070.1.81976 NP_651934.2.81976 FBpp0088160 FBpp0302676 FBpp0302677 FBpp0302678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]