SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001259133.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001259133.1.81976
Domain Number 1 Region: 286-316,371-403
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000000418
Family RILP dimerisation region 0.0084
Further Details:      
 
Weak hits

Sequence:  NP_001259133.1.81976
Domain Number - Region: 217-304
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0732
Family Seryl-tRNA synthetase (SerRS) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001259133.1.81976
Sequence length 486
Comment uncharacterized protein Dmel_CG11448, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPGFHLNEMGEMVLDAIDDIGVVDVYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLE
LLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVD
LVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKE
QIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERAD
FLAQLQDQSREINQLRKRLGLAEKENEDLVASYDDGQNDPNRPRYTTRELKELISERDEL
LTTIDTLNEQLAELKPPSQAKGKRQRHFSSSDDSDEDDDGHVADNDDDDDEEEAAAEANE
LEPPAAGETPPGHDAPVQGPLPYEPDDAPWKKSSESGIRKFFRKLFSDPSDGSNTFPKRS
LATLSKMALSATPGSVSASAAANLGNSLYLTLSLAIHLLRLSCTYIVYTLDCCALIILSC
YAILFT
Download sequence
Identical sequences M9PGM0
NP_001259133.1.81976 FBpp0304571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]