SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001259318.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001259318.1.81976
Domain Number 1 Region: 1599-1650
Classification Level Classification E-value
Superfamily RING/U-box 0.00000414
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001259318.1.81976
Sequence length 2218
Comment Ubr3 ubiquitin ligase, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDEDDNLSNADISIDDEEVVREQTHHPPMQEDQELDNEDGSSDVDLSSVYVVPPIVSAPS
PASVRIAGGSTIGGGGVAAGAVPTTTDNSHSPFHDWDSSVAAAAAPPPPPPRTGPTTTTS
SGTAAESGAASALSDDAGAKPSFFFGASSFSLRSRKEVAALINTECCRGSPTPDLDSIMD
TLFNPGTPIDNLDNIEWIRWLIAGGRTPQEFVKIVRSYDNHAKCGLVWVPHVVAYRCRTC
GISPCMSICRDCFKKGNHTNHDFNMFLSQAGGACDCGDTSVMKAEGFCSDHGINNRVNRD
PVPNNLLAVAEAIMPKLLFRLLQHFREHSDTPLEVQAITSYSCEEFANMLIDLNNMGEIM
RKVMTRTLINPEVYAFFMEAPCQDTRNGRFLKANREKYEDAVNRFPNPEPPDEYRDLPAL
GDKLVHTTLLEEFIFWTFKFEFPQTLVCFLLNMLPDQDYKEHLTRTFVMHYSRIPSVLEM
SRDPDTLSNRVVHMSVQLFSNESLALKMVNELSLLHVMIISLKLMMSKILIQNTLHDPNK
NFHFVIDCTRQVMKDHCYWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNV
NVRETASHVEFEPNSYYAAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHE
WLDSIYFMEARLSMEEMMQASFHFPLHRYLAAFVCQAVTKMGISLNDVLPSRPYLLPLLM
IHPLRVQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYF
FLQNTIELFDVGQWLETAPLKQPQKAEQSSMLEGFLTFLATLVTSRTNLGNDEATQCIIE
ISALLATENKTHSQLLELMPERSGNVHTKNFETFLKKLSVYKAPSSGSENLEQGLFTPID
EVWEKHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNLWPPFRLPHALPATSS
FSDPCKILNSRIFHSTILSIFFRAVHTRDVSEHLLALAVFLLEIAVETSDDVGSGTGDRA
PPALAAVVESSSGPGYHGYGTGRHEPPKLFHCYPTDNLSCNLRHVVKKVSLKSRDPQVIT
SSYRSNPFYSDLDFEVEADPEQSMRMIGQGDPEGDEATGGAGLGMGAHSRRNVSQALVPM
RVPGMEVALPPDLSVVAETGVVIRQDSNEDDLLREGNHAMDMSPPAALDFHFPLQQITLP
ESGMEVAIRRDLLLAETNNMGAIAGGAGGGANASATPPAGASNEMFSPTTPTGSGMLLPF
QRVQPVAVPSSGNMDIVPSNAMGAGGSFTSGVSGSGTGRRMNYETGGARKRSVDIAIGGS
NKDELHLDESILSLLLKLHSQLSGTLDSFSLSDGEDQSSDDDSTMDVDCNEASTSMAAAE
STALAERGRSKRNYKNIHVSSSRIGDGPFFIGNLLRKIAKQDEQCAQSIDDIRARLWPNQ
REKQAEAKAREAKEKEERRKKARERQQKMMQDFANKQKLFMQSAAASSSGMGYGPEDEDD
EELYEEQPREKEYDCIICNCTTPSTESNPIGLVVLVESSGIVGHRRRIAERLPLPINAED
ESRLAHTTRLAAEFNRRTELLSLKFGDESWYLSNNMAYDNGVHVQSCGHHVHLSCLEAYL
KTLYTTQRQPVQDRGEFYCPVCRQLSNSVLPLSPQLDRPTHLVRSGNQPFERLVADLTDL
IKENETIPPTKLTEAMGHAMEVMTNIAQRKVKCSSITFRKLFIFVTSIARTNLEAEIIQR
GGSLCTANATRYKPKRECIVPLLHVLSVHVRVLVEWPLWSSWASLAGLPVTATEPLPAHC
LELIPSILADPIALLLKFILLAPLQLDQDYFTCMVKVMYNLLYYQIVVQLCVTLTDLECD
HIVKVYGSTSVGSDNSAAESQQQESAAGTTNNRRRAGQQQQSSSQLGKAMALVLSQTNDL
VHLRRDCIPSTSSSAAASAAGSSSTTSTNHGASAATASSATTIEVNLKSMELQLQALCLP
FLRVAALLRQHLYRHEMPEISAPGLEFVRLVYYLELVTDSMDWDCFNASKGLCFIPGTET
TLPQFWCQQLMEVRPPADTVRELVLINQHSLWQQPRLLELPREYERLFTYYHERPCLNCY
KVPKESSICLLCGTIVCLKQNCCAENDCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRGRR
ACLWGSLYLDDFDEEDRDLKRGKPLYLSKDRFNLLESQWLSHKFAHTKHTWVFHRDLL
Download sequence
Identical sequences NP_001259318.1.81976 FBpp0303731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]