SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001259490.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001259490.1.81976
Domain Number 1 Region: 172-204
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000111
Family CCCH zinc finger 0.00028
Further Details:      
 
Domain Number 2 Region: 132-167
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000017
Family CCCH zinc finger 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001259490.1.81976
Sequence length 436
Comment Tis11 zinc finger protein, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSADILQKSREQDDSHYFERGDISKYVTMNDHLGDFDCNEVRKEIRMLLAHGANLDQQHQ
QQPHRHHGGLTRTISQPAQLIQQQQQQHQQQQQQQPAVASLVTITENLGNMNLHRKLERT
QSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTEYCR
TFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQ
SSNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLSMSTGSDRESPTGSLSLSPTNSL
TSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIGQGMIIGQGLGMGHHGPA
TPPESPNVPISPVHTPPPYDVVVSGSGAGNNSVGSKQLLQKSVSTPMQQEDTPRLPVFNR
LSSGVEAYQQQSNLGL
Download sequence
Identical sequences B3DN56 P47980
FBpp0073516 7227.FBpp0073516 FBpp0073516 NP_001259490.1.81976 NP_511141.2.81976 NP_727633.2.81976 FBpp0073516 FBpp0305898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]