SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001259895.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001259895.1.81976
Domain Number 1 Region: 581-955
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.84e-99
Family Hect, E3 ligase catalytic domain 0.0000049
Further Details:      
 
Domain Number 2 Region: 229-328
Classification Level Classification E-value
Superfamily E set domains 0.000000000801
Family Filamin repeat (rod domain) 0.024
Further Details:      
 
Weak hits

Sequence:  NP_001259895.1.81976
Domain Number - Region: 37-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000471
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001259895.1.81976
Sequence length 962
Comment CG4238, isoform H [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLKRSLKVLIAVVLSLMFTVSLVKIVLLIWSSHPAAPHSAPPLPTVDEWLESENLASYKH
LFRDKGISSLSSCGDPERLPELPPLDEQRLQRAALHLQQKLILREWLKDHRLQHHYQRLL
AVEVASLEDVYWLEDSRASKILGKDWQLWSGARQNLPTSKAQLDALKAQLWSTVVKSSQH
QDAWTWGGMLVVSVSVAGLVTLAAMTQPSLAPEARHSLLQYVTGKYLLPANCKVQWDWKD
PASVGGTMCFVVRFFQRNGQPYPICDTDHFFVEVTEGTRKVVTISELGSSTDPNNANIAK
VKFTVRTAGQYKISVLIGASHIAGSPFLRSFLPGAIDARRSRFIRPASTVICCAGAPTLM
HIEPRDEFGNSCLFDQNQSDEALQGYQVAIYDLHGVPVEKLQHAIVFAYDKVNSRVSVTA
LFPEPTCLRAVISYRDQQLPNGDFDIIVLSSSDTTLVHKNIASRKHNICYEAKLLSIFGV
SKNKPRKVLCYVGPKQVTIKEMILKFIPKRIATFRLCPSTKFHFLPQLVSQLHGPVFIID
DGAQPKIELASKDRNIIAATFTHFLLKNIGGSETFKDKQDFFYHEVRKFHASYYHEKMAL
KVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGG
LFCTFHDKHQALVHPNPTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSF
LAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTI
ELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENEL
ELLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQL
PPGGFQELNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFG
MV
Download sequence
Identical sequences M9PE16
FBpp0303522 NP_001259895.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]