SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001260032.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001260032.1.81976
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000144
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000455
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000487
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000543
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000077
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 14102-14125
Classification Level Classification E-value
Superfamily DPY module 0.00000484
Family DPY module 0.00058
Further Details:      
 
Domain Number 11 Region: 20349-20372
Classification Level Classification E-value
Superfamily DPY module 0.00000536
Family DPY module 0.00085
Further Details:      
 
Domain Number 12 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000568
Family EGF-type module 0.028
Further Details:      
 
Domain Number 13 Region: 10264-10287
Classification Level Classification E-value
Superfamily DPY module 0.0000085
Family DPY module 0.001
Further Details:      
 
Domain Number 14 Region: 13996-14019
Classification Level Classification E-value
Superfamily DPY module 0.00000942
Family DPY module 0.00098
Further Details:      
 
Domain Number 15 Region: 17186-17209
Classification Level Classification E-value
Superfamily DPY module 0.00000942
Family DPY module 0.00093
Further Details:      
 
Domain Number 16 Region: 19587-19610
Classification Level Classification E-value
Superfamily DPY module 0.00000994
Family DPY module 0.00087
Further Details:      
 
Domain Number 17 Region: 10599-10753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000118
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 18 Region: 13683-13706
Classification Level Classification E-value
Superfamily DPY module 0.0000123
Family DPY module 0.001
Further Details:      
 
Domain Number 19 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 15270-15293
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 21 Region: 18593-18616
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00095
Further Details:      
 
Domain Number 22 Region: 15698-15721
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0012
Further Details:      
 
Domain Number 23 Region: 16015-16038
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00087
Further Details:      
 
Domain Number 24 Region: 14741-14764
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00091
Further Details:      
 
Domain Number 25 Region: 14844-14867
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0013
Further Details:      
 
Domain Number 26 Region: 17291-17314
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00093
Further Details:      
 
Domain Number 27 Region: 11337-11360
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0011
Further Details:      
 
Domain Number 28 Region: 15375-15398
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.00083
Further Details:      
 
Domain Number 29 Region: 14635-14658
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.001
Further Details:      
 
Domain Number 30 Region: 18471-18494
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0011
Further Details:      
 
Domain Number 31 Region: 20144-20304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 32 Region: 9941-9964
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.00089
Further Details:      
 
Domain Number 33 Region: 16546-16569
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0014
Further Details:      
 
Domain Number 34 Region: 13788-13811
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 35 Region: 9834-9857
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.001
Further Details:      
 
Domain Number 36 Region: 10802-10825
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0012
Further Details:      
 
Domain Number 37 Region: 10909-10932
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0013
Further Details:      
 
Domain Number 38 Region: 14318-14341
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.00093
Further Details:      
 
Domain Number 39 Region: 16335-16358
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0011
Further Details:      
 
Domain Number 40 Region: 18150-18173
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0011
Further Details:      
 
Domain Number 41 Region: 18257-18280
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0019
Further Details:      
 
Domain Number 42 Region: 17932-17955
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0011
Further Details:      
 
Domain Number 43 Region: 12936-12959
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0013
Further Details:      
 
Domain Number 44 Region: 13572-13595
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0015
Further Details:      
 
Domain Number 45 Region: 20029-20052
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.001
Further Details:      
 
Domain Number 46 Region: 13360-13383
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0014
Further Details:      
 
Domain Number 47 Region: 9518-9541
Classification Level Classification E-value
Superfamily DPY module 0.0000497
Family DPY module 0.0013
Further Details:      
 
Domain Number 48 Region: 9198-9221
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0015
Further Details:      
 
Domain Number 49 Region: 9729-9752
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0017
Further Details:      
 
Domain Number 50 Region: 18698-18721
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0018
Further Details:      
 
Domain Number 51 Region: 17826-17849
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0016
Further Details:      
 
Domain Number 52 Region: 19694-19717
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0014
Further Details:      
 
Domain Number 53 Region: 20674-20697
Classification Level Classification E-value
Superfamily DPY module 0.000068
Family DPY module 0.0011
Further Details:      
 
Domain Number 54 Region: 14529-14552
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0014
Further Details:      
 
Domain Number 55 Region: 11767-11790
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0012
Further Details:      
 
Domain Number 56 Region: 12189-12212
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0013
Further Details:      
 
Domain Number 57 Region: 910-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000734
Family EGF-type module 0.021
Further Details:      
 
Domain Number 58 Region: 1017-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000778
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 59 Region: 16653-16676
Classification Level Classification E-value
Superfamily DPY module 0.0000837
Family DPY module 0.001
Further Details:      
 
Domain Number 60 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000891
Family EGF-type module 0.025
Further Details:      
 
Domain Number 61 Region: 16759-16782
Classification Level Classification E-value
Superfamily DPY module 0.0000968
Family DPY module 0.0015
Further Details:      
 
Domain Number 62 Region: 17415-17569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0001
Family Growth factor receptor domain 0.0064
Further Details:      
 
Weak hits

Sequence:  NP_001260032.1.81976
Domain Number - Region: 9626-9649
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13045-13068
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 13150-13173
Classification Level Classification E-value
Superfamily DPY module 0.000115
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 16973-16996
Classification Level Classification E-value
Superfamily DPY module 0.000115
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 10048-10071
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 12614-12637
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 15481-15504
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16120-16143
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 12406-12429
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 15162-15185
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17718-17741
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11871-11894
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 10484-10507
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11976-11999
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 20872-20894
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9304-9326
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11017-11040
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9410-9433
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15593-15616
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 14209-14232
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17613-17636
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 13466-13489
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 14425-14448
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 11247-11395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000282
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 20780-20802
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12827-12850
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 12512-12535
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12086-12109
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13891-13914
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 10158-10181
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17079-17102
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17398-17421
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 11125-11148
Classification Level Classification E-value
Superfamily DPY module 0.000445
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14918-15017
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000502
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 13252-13275
Classification Level Classification E-value
Superfamily DPY module 0.000615
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 12720-12743
Classification Level Classification E-value
Superfamily DPY module 0.000759
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 19824-19979
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000816
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 15820-15967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000837
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 10374-10397
Classification Level Classification E-value
Superfamily DPY module 0.00085
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 16868-16891
Classification Level Classification E-value
Superfamily DPY module 0.00085
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17680-17713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000904
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000926
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 16193-16290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00124
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 11657-11680
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 14750-14903
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 12295-12318
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 20472-20622
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 15059-15082
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 15278-15434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00196
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 21319-21342
Classification Level Classification E-value
Superfamily DPY module 0.00209
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 21449-21472
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 17892-17926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00243
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 15801-15824
Classification Level Classification E-value
Superfamily DPY module 0.00248
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 9795-9829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 18325-18419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00282
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 11939-11971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 17042-17074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 9090-9113
Classification Level Classification E-value
Superfamily DPY module 0.00301
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 17788-17821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00325
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 17944-18101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0033
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 16439-16462
Classification Level Classification E-value
Superfamily DPY module 0.00366
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 20938-20961
Classification Level Classification E-value
Superfamily DPY module 0.00366
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 12049-12081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 9586-9619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00472
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 19777-19810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00568
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 21060-21083
Classification Level Classification E-value
Superfamily DPY module 0.00772
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 984-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00948
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 10056-10216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 17361-17393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 14537-14692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0122
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 8770-8806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 11441-11464
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 20418-20451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0149
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 22095-22117
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 20098-20131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 13475-13635
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.018
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8989-9010
Classification Level Classification E-value
Superfamily DPY module 0.0183
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 10978-11012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 12845-12998
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 12626-12779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 17148-17181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0213
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 20456-20479
Classification Level Classification E-value
Superfamily DPY module 0.0222
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 11510-11543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0271
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 15558-15654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 20741-20773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 18555-18587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0309
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 19548-19582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 15125-15157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0341
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 11404-11436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 14702-14735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 11572-11715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 19993-20023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0447
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 9313-9469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0471
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 13010-13107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0487
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 16452-16605
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0487
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 11732-11762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0492
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 9051-9084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 10010-10043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0539
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 11087-11120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 13854-13886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0549
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 12576-12609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.055
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 21260-21281
Classification Level Classification E-value
Superfamily DPY module 0.0562
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 13647-13742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0612
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 22348-22370
Classification Level Classification E-value
Superfamily DPY module 0.0615
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 18660-18693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0634
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 22286-22306
Classification Level Classification E-value
Superfamily DPY module 0.0667
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 15232-15265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0689
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 12786-12821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0692
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 20634-20662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0709
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 15761-15796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0749
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 8620-8779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0753
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 18432-18466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 22169-22189
Classification Level Classification E-value
Superfamily DPY module 0.0824
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 876-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 13429-13460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0978
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 13215-13247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0988
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001260032.1.81976
Sequence length 22949
Comment dumpy, isoform Q [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNS
TSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTS
KNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCA
PNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTA
KSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATN
AVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQC
GAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPK
GLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCD
PSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGC
REPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSK
ACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPC
GRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGV
ALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPV
CACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH
IGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECA
PNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVP
KNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQN
PCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAEC
TVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVG
YFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEG
NPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLD
PPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMK
CRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCG
LFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNA
RCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSS
GAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPV
CMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPY
VECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVG
CHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSS
SECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPI
THDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACI
NLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPC
GANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGV
SAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVC
SCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCP
AGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPN
CRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCN
PQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSR
DKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDE
NPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDP
CPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNS
KCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCT
VIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCAC
LPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFD
GYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPEC
VVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV
KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQER
CVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCG
PHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNIC
GDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQ
AVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPIC
TCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFI
GAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDP
FVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADC
PRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIE
ACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC
AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPN
SICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAEC
RVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEY
QGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTG
DPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTV
NAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPP
PGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQA
CIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDP
CDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVC
GQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVC
ACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCN
TGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR
PECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKE
QERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNK
ACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQ
PCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPC
PGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNS
QCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGSCGYAAECS
VVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAE
FHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTA
GSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSE
CAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDV
APVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKC
VDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNA
VCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANC
QVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSC
LPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCIS
GYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAP
NCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNC
NPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRD
RACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPS
PCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCG
FNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSP
SCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCL
CDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDG
CRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICR
ITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAA
DKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREP
LDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRD
PCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCG
SNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICE
VLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITS
FIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTG
NPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVT
SSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQEL
DQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQK
CQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQ
CREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRV
VNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPAC
SCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCP
PGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRP
ECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTP
PPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQ
KCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSP
CGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGS
SATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGAC
QCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNC
FAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNC
RPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIP
RPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINA
ECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSRE
EPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTD
PCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECRE
QNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNH
SPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNF
FGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGD
PFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVL
DSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIR
EYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKC
LDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSP
CGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPCPGSCAY
NAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQC
SCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRC
PERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRP
ECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEP
VRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKA
CLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSP
NPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGV
CALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENN
EQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAP
ICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSY
FGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGN
AFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLST
ECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRD
VIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCR
DPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGAN
AECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAEC
YVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLP
EFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGY
QGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPE
CTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPP
AITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCAS
HLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDA
CNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGA
CGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVND
QAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPH
CSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIG
TPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPY
TGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSD
CSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVV
HFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCT
DPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSP
CGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGL
NARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNG
VCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMC
QCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPA
CRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECH
LIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSEC
PSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATP
PTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPECILNS
DCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESP
LTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVD
PCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIPD
LVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYPS
PQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGNLSPTPQPGVINIPS
VSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIP
VQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDV
NYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPV
APTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGV
VNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYD
VYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHR
NPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIP
SIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPGVINIPQQPTPPP
LVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQ
DTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEP
IPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGP
YSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCRDPCPGSCAYNAV
CRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCS
CIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCP
EGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAI
CYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVC
PPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF
CRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCS
RPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPS
HRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVN
PCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC
PGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYS
QCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCS
VINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEY
HGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTG
NAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECY
SSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPR
VPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMN
QKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYP
SPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPG
VCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNE
KAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHS
PVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDC
SRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPE
CISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLL
GCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCER
PECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPT
QPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGE
ADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCP
ERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSR
PICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQN
HQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVG
RRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCT
PQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGN
CLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDC
PRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGC
KSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSD
DECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHS
DYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPV
EPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDA
SGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFE
GNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGY
RGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVD
FLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRT
MLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRI
KDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLA
IEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCK
VYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVN
AFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDI
YEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPE
CTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNH
TNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPR
TEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVS
MLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFARSCIAK
TMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRV
CFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEKR
SGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTI
APLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PB30
FBpp0304622 NP_001260032.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]