SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001260160.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001260160.1.81976
Domain Number 1 Region: 2506-2574
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000169
Family IBR domain 0.00088
Further Details:      
 
Domain Number 2 Region: 2419-2475
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000777
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 2588-2659
Classification Level Classification E-value
Superfamily RING/U-box 0.00000038
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  NP_001260160.1.81976
Domain Number - Region: 681-706
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000251
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00238
Family B-box zinc-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001260160.1.81976
Sequence length 2798
Comment uncharacterized protein Dmel_CG11321, isoform J [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTTHQLLNKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEPDYE
IIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAGQIFCASCDDMFHK
HPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPRRSKRGLLTPFLGRKDQMLPPPSP
TPSHKSLGGWRGSLGGGATPPVPPIATSSANQMNNRPLPDPPRSEGGGSSRSGTPKSVFD
TIQRPPSVQLEKIKSKASATLDRMAILQQRYRQQKARQDLSANSEQAAGAQRRQMSTSVF
NLNSNPRRPLSEAQNGGAWLANQRIQQAQSLAQLNCAGCQQSQQHPGWAQHPHQALPQHQ
HPDQWSQFGSQQQFNNSNLSLNVGPGYMSQQHHPHYPPPVFMTQRGMMPNVYPGAPGYPM
MHPGVMGMPPSAASRAASRSRYAASPTPSRKSMSLRRKRNSYVDDELTDDEDSDQDDRRS
LVSNRSGMTSASRSQHHQNHIQPRQRRLSSASQLIASDELDGDQVHHKMRNRRGSIAKSV
QSEWLPERRENEGTLTRNKTATDSARTSRIYSDLESEGSGARALVQAKIQQKLQEADQHK
SSKKAEPKRKPEMKDENTQAAAVVQKVVVPPAHEESASEYEEVVEEVTASESEAEAQTAP
DPQEVPDEIGADDLGPPPSTPDHEWECEFCTFVNEPNIKICSICCKTPSKPPVQPNKAKK
VEEKPQPPAEKSNNIKASSKTETKPVQKPTTKSQQPSQKSVAALSKTTHTNSTSSSKASP
AVNSKTTSSIPIKTPSKSTLKTSSENESDNSLAKSLLHKESVENIWNTLDESIQAQAEQV
LKKAQKVSTACGGTPPREIAAVEMGTSPPPQSISTQTYDALPFNTKQEEIIPVVPDRFTT
PEPNKMERRPHYRSNSQLQQESERYRSANDLRYHDGFGLDPYSAGLVTKRPNFINELRML
QLQVSSPFDMPHETFGVKHEPARDPETEMHIILKELELYKFTVEELEAALKYCSPETHPI
QWLRENWHKLVQTVQSLSTKYGQERGENTIGTVSQNEAREALRNSGGNVWQAVADCIQQR
QQKYRKLAAKGNFLRDDIVNALTAHQDIHDFLNTHALDCLQPPLAGQSPSPAQANPFDQP
RTDESPVKSTYATPSPYQMEDSTLKNLEILIGNMEQNQAKQNQEVLRSIETMLDTFKGKP
ELEYETDPEIMRILTKSPISTMKPSGPAEDKSTDDVKNFVWQHIQEIVPNLVQQVEQELM
EKPEEVAKIEAEQPKEPEPLLEPQPEPTPSVDPAVYIMEEVIKPNLREASIREEVQPSFI
YATEIANFKLEFDRGTERWHEAEWESSDLTDAERIVYKCYMAPNEQPKEDVVDVAVESSV
NSLPTAKAQEESAPEVPIEAQKIENTEVTQPETVNEELRQQEKLETPLVITSETISETVS
QTANESDKQKSIENNLQIKQNVAEVQVQSDDQPSTSRDANRRAKRSQQSRKGRSREQSQK
PTNRTKLPNNIDQKVNESKTAAKETEAVKDKDLSAAASNIQSDVTASDPKTSTPLKILSE
GTNSNTLETMENVTSTDINDNVTIEVISNRSEEVPAIQDLGKTKDISEPTANPIEEITSI
QNSTTISEQSEGPQEPEIPIEVSETTEALQVPREEASIEIVSPPNEEQTKSPTSQEVNIQ
DTSHIISLPITDVTPTPEIINIAPSTSSISKEQKQSPKRLSKIPVRTLSSSSLRSESRSS
NRTPTANDEIEREETTSQGVPIGETVSSPKSEQLSDNQEVNLVSQETQSKKDTNIVEEPA
TQPLGLELEEHSPNATAVAVSPTDSDEVFEDAPEFSGSDGTRPHDETASDAELYSLDSDG
QRAETKSPEDEVVILLDEESQMESSIAQSESNASLDSHSSESETSKVVLKEFVPSGDPAK
QNLSELVEDTQRLIKQMRDEISMDEFESTDEDEYSDEYSDEYDEGEEEEWYDSEGEEEGD
FDGEEGNTYNEHASYIEEASTGDEGTEIEDIMEEDEDLADDDEPLQSQIPLDIEPVISPA
LSVTPTNQETDTIAHTEVVSSTGTRLETELPNPAMESILPSQSVQEDIKVEAIPIQSAPP
IADSETRPAEQPVELVLEIPSEVEPTPVEEPTALPITPAPPIVDSESRPVEPPVETVLEE
PKKVTPSMKGKTANSGTASKGPSTSSSTKTNKSTVSKIPKPTNEPTNKSNSTPLNKKVPL
RSKSFSAPMGISSVKRIQEVYLQKQSSSIATSRVPLKSSPVTKKSINDAISRFNSNQADG
PSTSGAAAAAAAALLKPRSQPRIPKKKYHETCFSDDDYETSATEEEQEEPNLAEPQKAEQ
LKRKMSMPVFRAYPSVQEPVIEDPAILARKYVDQELVTNIAEAQIAATLVSMKFSEDVAL
WAARECSDLDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSI
NDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPN
FKWCIQCSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPEL
QAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVST
YCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQAR
CPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFDLTDCVQ
ELRRRGIALPERGPWDTDEIYKNMCSEVIKKHIPLKSA
Download sequence
Identical sequences M9PCD7
FBpp0303663 NP_001260160.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]