SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001260930.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001260930.1.81976
Domain Number 1 Region: 202-530
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000129
Further Details:      
 
Domain Number 2 Region: 55-180
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.96e-27
Family Anticodon-binding domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001260930.1.81976
Sequence length 531
Comment Aspartyl-tRNA synthetase, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVEDKEQVANGEQVSKKGAKKLAKAAKKAEQKAENASTAAANNAGGDSAEDHAAGRYGLS
EMIQSKDKRSERNFVPVSELSGQVGKGLVWVRGRVHTSRAKGKQCFLILRQQSSTVQCIL
AVGDVISKQMVKFAGNIPKESIIDIQAKPVAVSSKIESCTEQSLELSVEQIFVISQAKAQ
LPLQIEDASRPENADDAEGLNIRVNQDTRLDNRVLDLRTPANQAIFRLEAGVCRLFRDIL
TEQGFTEIHTPKIISAASEGGANVFTVSYFKDSAYLAQSPQLYKQMAIAADFDKVYTVGA
VFRAEDSNTHRHLTEFVGLDLEMAFKYHYHEVLHTIGNTFTSIFKGLRDKYAKEIESVGQ
QYKVDAFKFLEPPLILQFADGVAMLREAGVETGDEEDLSTPNEKLLGRLVKAKYDTDFYI
LDKFPLAIRPFYTMPDPNNPVYSNSYDMFMRGEEILSGAQRIHDPEYLIERAKHHGIDTS
KIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNIRKTSMFPRDPKRLTP
Download sequence
Identical sequences Q7K0E6
FBpp0086897 FBpp0305104 7227.FBpp0086897 7303387___KOG0556 FBpp0086897 NP_001260930.1.81976 NP_001260931.1.81976 NP_476609.1.81976 FBpp0086897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]