SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001261524.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001261524.1.81976
Domain Number 1 Region: 226-518
Classification Level Classification E-value
Superfamily L domain-like 5.95e-42
Family Internalin LRR domain 0.033
Further Details:      
 
Domain Number 2 Region: 63-285
Classification Level Classification E-value
Superfamily L domain-like 1.25e-31
Family Ngr ectodomain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001261524.1.81976
Sequence length 817
Comment larval translucida, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTSLVYTVFHLASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVVDSLANKLNAD
TNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSLPEVPFRGLSNVTYLSIGDND
LDEIPKHALSHMPSLLTLDIGRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGSFPKS
LLILHLGRNQLESLNGSLHDLHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERL
PANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETL
QMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRLLPD
PRGVQELMLVNLDLDNNRIDSLNGALAGLGNLRILNLAGNRLEHLQVGDFDGMIRLDILD
LTGNQLAELKPLEMTLLPSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSEL
VTNTRCKNHNVPGKLEIHLDDNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTV
LPMLYNVNLPIMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLISTDL
VNPVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQETTTTTSTTTTT
TTTETSSQVAPIEIITTTAPTTTTTSTTTPKPNETLPVIVELQDPNPPDTTVNQTALVPP
VVLDPLQQDLERERERERERELERDLDHEAVAKTEYETVEYIPNLVQPPVGSDALTPPPS
KANALEEDSESVHSNSVHAEYPHAAQSLQIPEEPPEE
Download sequence
Identical sequences Q9VS84
FBpp0076507 FBpp0076507 NP_001261524.1.81976 NP_729265.1.81976 7227.FBpp0076507 FBpp0076507 FBpp0304454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]