SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001261720.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001261720.1.81976
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.44e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.002
Further Details:      
 
Domain Number 2 Region: 79-160
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000933
Family Cold shock DNA-binding domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001261720.1.81976
Sequence length 240
Comment CG7339, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIIL
PGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRF
DEAEQAWVWEYPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTS
AAVASATSQEVKTPYRIIGAINESGLGVLSWWDQQGKDDEQDDEEDEEYDDEDGEGACEE
Download sequence
Identical sequences Q9VTL6
FBpp0075838 FBpp0303920 NP_001261720.1.81976 NP_648490.1.81976 FBpp0075838 FBpp0075838 7294695___KOG3297 7227.FBpp0075838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]