SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001261904.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001261904.1.81976
Domain Number 1 Region: 193-315
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 7.45e-60
Family USP8 interacting domain 0.00000457
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-19
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 3 Region: 79-151
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000981
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001261904.1.81976
Sequence length 315
Comment early girl, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MGYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSL
TTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGC
GFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAM
RVSNPAMRAIADQMERDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIKRALSESGCPP
HILDSLMEFCHERRWPRGLSSLETRQTNRRIYDNYVCRRIPGKQAVLVLSCDNLHMTEDV
MIDPGLVMIFAHGIE
Download sequence
Identical sequences Q9VUV7
NP_001261904.1.81976 NP_648816.1.81976 FBpp0075265 FBpp0305750 FBpp0075265 FBpp0075265 7227.FBpp0075265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]