SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001261913.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001261913.1.81976
Domain Number 1 Region: 457-762
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.3e-61
Family Ankyrin repeat 0.0000643
Further Details:      
 
Domain Number 2 Region: 128-203
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.96e-22
Family Mib/herc2 domain 0.00074
Further Details:      
 
Domain Number 3 Region: 48-122
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-21
Family ZZ domain 0.0045
Further Details:      
 
Domain Number 4 Region: 12-56
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 0.0000000445
Family Mib/herc2 domain 0.0065
Further Details:      
 
Domain Number 5 Region: 1051-1110
Classification Level Classification E-value
Superfamily RING/U-box 0.000000932
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  NP_001261913.1.81976
Domain Number - Region: 855-899
Classification Level Classification E-value
Superfamily RING/U-box 0.00053
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Domain Number - Region: 902-946
Classification Level Classification E-value
Superfamily RING/U-box 0.00102
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001261913.1.81976
Sequence length 1115
Comment mind bomb 1, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHFGYSFRILISDGGEGHVGTVRNFESAEEVVVVWDNGTAANYRCAGAYDLRILDSAPTG
VKHEGTMCDTCRQQPIFGIRWKCAECINYDLCSICYHGDKHHLRHRFYRITTPGGERTML
EPRRKSKKVLARGIFPGARVVRGVDWQWEDQDGGVGRRGKVNEIQDWSSASPRSAAYVIW
DNGSKNLYRVGFEGMADLKVVNDAKGSNVYRDHLPLLGENGPGKGPHGFQIGDKVTVDLD
LEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSP
TTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVG
NTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEPNVSGDATEEFVKAAAN
GFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHA
VDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVK
TLLTLGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKG
NPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQ
TALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKL
LMGLRNANNKKASASIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTD
DSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASSSSIFALNGIANE
MSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSR
EKIDECLVCSDRRAAVFFRPCGHMVACEHCSALMKKCVLCRTQIDEILSFSLCCGGSGRP
EKVSVAAGAMATVGLPLPDDRFMEAAAAAACANASGHSVAMNNTVVTPVAGSSNQLNSQN
NLLAAAAASSNVSNLSAAGNAMVAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIK
NMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF
Download sequence
Identical sequences M9PI73
NP_001261913.1.81976 FBpp0305755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]