SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001262433.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001262433.1.81976
Domain Number 1 Region: 191-515
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.38e-105
Family Protein serine/threonine phosphatase 0.00000000197
Further Details:      
 
Domain Number 2 Region: 49-161
Classification Level Classification E-value
Superfamily TPR-like 1.02e-29
Family Tetratricopeptide repeat (TPR) 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001262433.1.81976
Sequence length 520
Comment protein phosphatase D3, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSSSELEVQKAADCQQEAKVPASVEITGSKQPEEDTNARTKAELDFAAAEQYKNQGNEML
KTKEFSKAIDMYTKAIELHPNSAIYYANRSLAHLRQESFGFALQDGVSAVKADPAYLKGY
YRRAAAHMSLGKFKQALCDFEFVAKCRPNDKDAKLKFTECNKIVKMRAFERAIAVDKPEK
TLSEMYSDMENITIEDDYKGPQLEDGKVTLKFMKELMEHYKAQKRLHRKFAYKILCEIDT
YMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSF
SVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWL
PLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQS
KRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNM
GAFITITGNNLKPNYKSFEAVPHPDVKPMAYANSLMNWLA
Download sequence
Identical sequences Q9VH81
7227.FBpp0081606 FBpp0081606 FBpp0081607 NP_001262433.1.81976 NP_524946.1.81976 NP_731398.1.81976 FBpp0081606 7299242___KOG0376 FBpp0081606 FBpp0081607 FBpp0304082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]