SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001262995.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001262995.1.81976
Domain Number 1 Region: 849-997
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-42
Family Toll/Interleukin receptor TIR domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 330-580
Classification Level Classification E-value
Superfamily L domain-like 7.14e-33
Family Internalin LRR domain 0.07
Further Details:      
 
Domain Number 3 Region: 138-327
Classification Level Classification E-value
Superfamily L domain-like 5.78e-29
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 4 Region: 647-784
Classification Level Classification E-value
Superfamily L domain-like 7.94e-19
Family Ngr ectodomain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001262995.1.81976
Sequence length 1117
Comment toll, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSRLKAASELALLVIILQLLQWPGSEASFGRDACSEMSIDGLCQCAPIMSEYEIICPANA
ENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILD
YLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLE
LRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHD
FEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRL
MNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPAT
LLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLV
MSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNL
RNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALP
EDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQP
NVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPR
LPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLD
ISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMM
CVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYA
HNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVG
GHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGD
VEKLDEELKAYLKMNTYLKWGDPWFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDKL
ELIKPSPVTPPLTTPPAEATKNPLVAQLNGVTPHQAIMIANGKNGLTNLYTPNGKSHGNG
HINGAFIINTNAKQSDVXDWEKAELFQFDPDDELLFR
Download sequence
Identical sequences A0A0B4KHY4
NP_001262995.1.81976 FBpp0303187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]