SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001263151.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001263151.1.81976
Domain Number 1 Region: 45-277
Classification Level Classification E-value
Superfamily L domain-like 3.74e-37
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 273-369
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000119
Family I set domains 0.011
Further Details:      
 
Weak hits

Sequence:  NP_001263151.1.81976
Domain Number - Region: 639-746
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000968
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001263151.1.81976
Sequence length 843
Comment kek6, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHRSMDRRRSRTPRTLPVCWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQL
TTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKI
LVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLIS
YIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWY
VNSRLSSVSLVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLV
YGDPLPEVAWELNGKILDNDNVLFESESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIG
SMTQNISIYLSEIVQHVLEKTPETFWYFGLIMGIFGTVFLLISISFVVCLCKRTTRQHRH
ANKAGVKSSVSFNDQEKKLLDSSVTTTTNDRGDSYGIDNQPTSIGMNKGDSAGMGFNQIE
IHAVESHRHGSMLVQQQPQQQQVAGGGGMRQQLMQVKDSTCGMMSVPTSMAGHAHSHPAQ
ISEEFPLNVGVFPPPPEFCSNIVPNPAFGGNIFIRVSVTQDMLDGADLNMYPDLLNIPKR
MQDVQESGAGAVAVPEGQFATLPRHTARRGILKKDTSLQQQQQQHQQQHQHQQQQQQQQI
QQQQHQQLQQQHQPSGLYTHDEIVTYNLEASGYDPHQSGYHSNAMELPPPPPPPAVTAVV
QCHHPSPNNCASCINNAPPPPSACQSPPVEVTPMRPLDSSAYPKYDNMGRRITASGGLGG
SNLSLHDEERYENETLFGQAESQTKGMPEQSQDLHQPQEVTQGQDKGGGPGEFVSLXYYG
TQV
Download sequence
Identical sequences A0A0B4KHL5
NP_001263151.1.81976 FBpp0303140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]