SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001265580.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001265580.1.87134
Domain Number 1 Region: 431-586
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 8.24e-60
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000525
Further Details:      
 
Domain Number 2 Region: 9-379
Classification Level Classification E-value
Superfamily RNI-like 4.71e-56
Family Rna1p (RanGAP1), N-terminal domain 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001265580.1.87134
Sequence length 587
Comment ran GTPase-activating protein 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLS
DNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPL
ALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRV
INLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL
SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
EDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVF
KDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLM
ALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Download sequence
Identical sequences A0A024R1U0 P46060
NP_001265580.1.87134 NP_001265580.1.92137 NP_001304859.1.87134 NP_001304859.1.92137 NP_002874.1.87134 NP_002874.1.92137 XP_006724352.1.92137 XP_011528596.1.92137 XP_011528597.1.92137 XP_016884382.1.92137 XP_016884383.1.92137 XP_016884384.1.92137 XP_016884385.1.92137 XP_016884386.1.92137 9606.ENSP00000348577 ENSP00000348577 ENSP00000385866 ENSP00000401470 ENSP00000348577 ENSP00000385866 ENSP00000401470 ENSP00000348577 gi|4506411|ref|NP_002874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]