SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001266082.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001266082.1.44838
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.42e-21
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001266082.1.44838
Sequence length 190
Comment IAA22 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MATIYENNDLATELRLGLPGTTDKSKTRVSSTSTTNKRSLSEMDSSSDIINQNDQQDSSP
PPKVQIVGWPPVRSCRKNVGVQAKNSIDISIGMYVKVSMDGAPYLRKIDLRVYKNYQELL
KALEYMFKHPIGVFLEKEGYTTSGSDYVLTYEDKDGDWMLVGDVPLDMFISSCKRLRIMK
ESDAKGLGCL
Download sequence
Identical sequences G9HPW8
Solyc06g008580.2.1 NP_001266082.1.44838 Solyc06g008580.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]