SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001266091.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001266091.1.44838
Domain Number 1 Region: 139-224
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000235
Family PB1 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001266091.1.44838
Sequence length 227
Comment IAA29 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MELELGLAISNCNHFPINAITSYRKNGFDDSFSDMKMKMKQKRCFEEAFHEDEGVVERKT
LSLFIWNGQPNEDDDNHGRNKKPFNATCHKDFEEESLKLLGWPPINTWRKKQFHHQGHAG
WITNDRNNNNNNNNNVIVGGRNSMYVKVKMEGVPIGRKVDLRLYHSYQLFTQNLLQMFAR
YQNSGKNSTRFTILYQDREGDWMLAGDVPWKTFVETVQRIEIQKNEK
Download sequence
Identical sequences G9HPX2
NP_001266091.1.44838 Solyc08g021820.2.1 Solyc08g021820.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]