SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001266599.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001266599.1.27298
Domain Number 1 Region: 322-392
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-22
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 81-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000628
Family Intermediate filament protein, coiled coil region 0.0028
Further Details:      
 
Weak hits

Sequence:  NP_001266599.1.27298
Domain Number - Region: 86-225
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001266599.1.27298
Sequence length 430
Comment uncharacterized protein LOC101149839 [Gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTSDHCSSLLSGQVSEANAASLCLLANVAHANRVRVGSTPLGRLSLCLPPTCHTACPLPG
TCHIPGNIGICGAYRENTLNGHEKETMQFLNDRLANYLEKVRQLEWDNAELETKLHERSK
CHESSVCPNYQSYFCTIQELQQKILCTKSENNKLVVQIDNAKLAADDFRTKYETERSLHQ
LVEADICGLRRVLDNLTLAKCDLEAQLESLKEELLCLKKNHEQEAHTLRGQLGDKLRIEL
DIEPTIDLSRVLGETRGQYEAMVETNRQDVEQWFQAQSEGISLQAMSCSEELQCCQSEIL
ELRRSVNALEVELQAQHTLKDCLQNSLCEAEDRYCTELAQMQSFINNVEEQLSEIRADLE
RQNQEYQVLLDVKAWLENEIATYRNLLESEDCKFPCNPCATPAFSTPSPAPAACAPCSRA
THGPCSSTGY
Download sequence
Identical sequences G3RT05 Q9GJW5
ENSGGOP00000018930 NP_001266599.1.27298 ENSGGOP00000018930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]