SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001269283.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001269283.1.92137
Domain Number 1 Region: 34-278
Classification Level Classification E-value
Superfamily vWA-like 8.34e-87
Family Integrin A (or I) domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 276-363
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-23
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 527-610
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.02e-18
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 485-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 5 Region: 443-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  NP_001269283.1.92137
Domain Number - Region: 410-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001269283.1.92137
Sequence length 693
Comment integrin beta-6 isoform b precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MGIELLCLFFLFLGRNDHVQGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKEL
GSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILP
LTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSH
FGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQV
HLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICN
NGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCD
CQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRG
DCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCN
CTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHL
SAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIH
SINEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQ
TGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
Download sequence
Identical sequences A0A087WXP3
NP_001269283.1.87134 NP_001269283.1.92137 ENSP00000481183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]