SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001269317.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001269317.1.92137
Domain Number 1 Region: 87-331
Classification Level Classification E-value
Superfamily vWA-like 1.05e-86
Family Integrin A (or I) domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 329-416
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-23
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 580-663
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.12e-18
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 538-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 5 Region: 496-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 6 Region: 38-113
Classification Level Classification E-value
Superfamily Integrin domains 0.0000157
Family Integrin domains 0.0023
Further Details:      
 
Weak hits

Sequence:  NP_001269317.1.92137
Domain Number - Region: 463-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001269317.1.92137
Sequence length 746
Comment integrin beta-6 isoform d [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MITYKNFTHPSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIV
QIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKE
MSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAER
FNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKL
AGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYA
KLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQH
QKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEV
NSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQC
ICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCNCTTSTDS
CVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAR
EECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDC
PKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLY
RGSTSTFKNVTYKHREKQKVDLSTDC
Download sequence
Identical sequences E9PEE8
ENSP00000408024 NP_001269317.1.87134 NP_001269317.1.92137 ENSP00000408024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]