SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001270756.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001270756.1.63531
Domain Number - Region: 16-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000158
Family Glutathione peroxidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001270756.1.63531
Sequence length 229
Comment redox-regulatory protein FAM213A [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKE
PRTLKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTE
VEDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFI
LGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK
Download sequence
Identical sequences A0A096P4F7 A0A2K5KLB3 A0A2K5XTF1 A0A2K6D6E0 H9Z3J8 I7G9X7
NP_001270756.1.63531 XP_005565341.1.63531 XP_007960969.1.81039 XP_007960970.1.81039 XP_011712884.1.29376 XP_011712885.1.29376 XP_011831119.1.47321 XP_011831127.1.47321 XP_011886238.1.92194 XP_011886239.1.92194 XP_015002620.1.72884 XP_015002621.1.72884 ENSPANP00000020232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]