SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001274361.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001274361.1.87134
Domain Number 1 Region: 152-350
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.89e-70
Family Arfaptin, Rac-binding fragment 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001274361.1.87134
Sequence length 373
Comment arfaptin-1 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGV
IEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQ
TLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIA
SVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH
KEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLK
TPGVDAPSWLEEQ
Download sequence
Identical sequences B4E273 H2QQA4 P53367
NP_001020766.1.87134 NP_001020766.1.92137 NP_001274360.1.87134 NP_001274360.1.92137 NP_001274361.1.87134 NP_001274361.1.92137 XP_008967154.1.60992 XP_008967155.1.60992 XP_009446691.1.37143 XP_009446692.1.37143 XP_011530171.1.92137 XP_011530172.1.92137 ENSP00000296557 ENSP00000395083 ENSPTRP00000028360 ENSP00000296557 ENSP00000395083 ENSP00000296557 9598.ENSPTRP00000028360 9606.ENSP00000296557 gi|71040094|ref|NP_001020766.1| ENSPTRP00000028360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]