SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001274656.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001274656.1.63531
Domain Number 1 Region: 126-225
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-18
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 2 Region: 239-331
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000825
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  NP_001274656.1.63531
Domain Number - Region: 30-82
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00236
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001274656.1.63531
Sequence length 420
Comment interleukin-5 receptor subunit alpha precursor [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MIIMAPVLLILLGATEILQADLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHA
PPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQIN
PPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRQWFLIVLMATICFILLILLL
ICRICHLWIKLFPPIPAPKSNIKDLFVTANYEKAGSVETEIEVISYIEKPGVETLEDSVF
Download sequence
Identical sequences A0A1D5Q7M2 C3VEW9
ENSMMUP00000002460 NP_001274656.1.63531 9544.ENSMMUP00000002467 ENSMMUP00000002467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]