SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001277249.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001277249.1.92730
Domain Number 1 Region: 544-576,718-792
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000487
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001277249.1.92730
Sequence length 999
Comment testis anion transporter 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MQTERSLQSFSNRYTQIPFVYDVKRSVYNEENFQQEHRKKGPTSGNVDIDITTFKHHVQC
GCSWHKFLRCMLTVFPFLEWICLYRFKDWLLGDLLAGLSVGLVQVPQGLILSLLTRQLIP
PLNVTYAAFCSSVIYVIFGSCHQMSIGPFFLVSALMINVLKDRPFNNGHLILGTFVKDDF
SVPTFYLSYNRSLSMVASTTFLTGIIQLSMGMLGMGFMATYLPEAATSAYLAAVALHIIL
AQMTCILGIMVSFHAGPISFIYNIINYCIALPKANSTSILLFITSVVALRINKCIRITFN
RYPIEFPMELLLILGFSLLTSKITMATENSKMLMNMIPYSFVFPENPEFGILSRVVLQAL
SLSFVSSFLLISLGKKIANFHNYRTNSNQDLIAIGLCNLLSSFFKCCVFTGSLSRTTIQD
KSGGRQQFASLVGAGVMLLLMVKMESFFHNLPNAVLAGIILSNVVPYLEAIYNLPSLWRQ
DQYECIIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHRTKILVLGQIPNTNIYRNVN
DYREVILIPGVKIFQCCSSITFVNVYHLKQKVLKEVNMVKLPLKEEEIYTLFHESETSIA
ENKLCRCFCDCEELEPEIRVVYTERYENRQEQDSSINLIRCSYLGSGDSSQVTSEEQIPY
TVSSTSQRNIVQSYEDTEKAWLPNSPPRNSPLPPPEASESLAQSRSRSIIMPYSDTSVQN
NTHTIILDFSMVHYVDNRALVILRQMCNAFYNANILVLISGCHTSVVKSFEKNDFFDEGI
TKAQLFLSLHDAVLFALSRKFSEPSDLSMDETETVIQETYSESDKNGNLSNLRLKTGKAI
IEGSQHASPGFTKNLKPGKDDLEFDLELDPMLSFEQSSGMDLNLDLDLDLDQSELDPGSE
LDSEIQAKPELELESELETDAQTEPETEEEPELEPEPEPEPETEPEPEPERERKTRTRSQ
SPWRNYFTAYRFGSSNSQSRAPPQTRPEKRKPHNYPNSP
Download sequence
Identical sequences Q8R0C3
ENSMUSP00000110412 ENSMUSP00000110412 10090.ENSMUSP00000110412 ENSMUSP00000110412 NP_001277249.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]