SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001277917.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001277917.1.92730
Domain Number 1 Region: 294-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-63
Family SPRY domain 0.000008
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-22
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 82-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000427
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  NP_001277917.1.92730
Domain Number - Region: 126-207
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0327
Family Apolipoprotein A-I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001277917.1.92730
Sequence length 483
Comment E3 ubiquitin-protein ligase TRIM11 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
AQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLTTFCGDDLSLLCPICERSEHW
THRVRPLQEAADDLKGRLEKSLEHLRKQMEDAMLFQAQAEETCALWQKMVESQRQNVLGE
FERLRRLLAEEEQQLLQKLEEEELEVLPRLREGAARLGQQSTQLAALISELESRCQLPAL
GLLQLCIECCALEREASIAKDIKDALCRVQDVKLQPPAVVPMELRTVCRVPGLVETLRRF
RGDITLDPDTANPELVLSEDRRSVQRGEQRQALPDNPERFDPGPCVLGQERITSGRHYWE
VEVGDQTSWALGVCKETANRKEKGELSAGNGFWILVFLGSFYNSNEPAFSPLRDPPKRVG
IFLDYEAGHLSFYSATDGSLLFIFPETLFSGTLRPLFSPLSSSPTPMTICRLIGVSGDTL
GPQ
Download sequence
Identical sequences ENSMUSP00000104437 10090.ENSMUSP00000104438 NP_001277917.1.92730 ENSMUSP00000104438 ENSMUSP00000104438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]