SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001281237.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001281237.1.92730
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Globin-like 1.07e-31
Family Globins 0.000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001281237.1.92730
Sequence length 155
Comment neuroglobin isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSVGSGTVGESLLYM
LEKCLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE
Download sequence
Identical sequences Q3USR6
NP_001281237.1.92730 ENSMUSP00000105806 ENSMUSP00000105805 10090.ENSMUSP00000105806 ENSMUSP00000105806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]