SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001284976.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001284976.1.81976
Domain Number 1 Region: 417-440
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000157
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001284976.1.81976
Sequence length 1000
Comment CG1677, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVLDMESDDSHASSASNSSESRSNSPTNDKDEVVADHGGESPGGGGDPILDRSDRAPSTS
SSSSNSSSSSNRSDLSKKQKKSSSSSSGSGSGSGSSSSSGSSSEDEGDQEPEQEVQRLSE
QQREQQQHSPINERESESAAGTPVNADQPGSPNAKSQPSSFLSSVRSRSVSPQLYNQAAV
DLNISHDDLSDVSDIEGEEKRTSSKNSMRPADENEDGAISNDSLPTLGEEDEVEQKQSTP
NGKASSGDEKEPFAKETHTDDASNGLAPATALQEDLVKTHDDDALDFEAEEGECPEQAKE
PSPMESTANETNQTKSTTKVSQDEGDDDGEVDKDGDDKDGDDKDTRKDGAGNGCLEDGAG
NDSRKDDAGNGCLEEGEEEKDIVSVSTSSSQEKVEEGELEEGEVSDEDEKRPEETEPKPV
CRFYTRGQCTWGMSCRFLHPGVTDKGNYTMFDNVIRPVPMQGGSTGASAPAAPSSTAAPR
AGGSAYSSHASATADYHDYRTERPLHHRPPLLHAPSIYGAPVHDARTLLPDGAPVVVENA
WERGLRTAKEMMRKANKRKEQDMDFEDKKMNLTLSPDEMEKDSYYLKDRGGSSARSPPPP
SANVREQPLNPLSMPLSMHPHAVAHANPRALLPLQYSVYGPPPDRYGRPQYMPPQYDDVD
AYGRMTRYRELPPHRMPHYEDDRRSRPTREVIVQRVEAAGRGDEWSDPWMRSKSVGRGSY
EREDRRRRDRRSYSSNSSYSTSNSSQSDSSSDSSRSSSPSDHKRRYGSHKLATATATSRR
HGGRAARSPSQIPRRPRRTSKGSLSPSYKRPAVDKRGVGHSPSSKRKKLSSPAPKKFDKL
RRRRSSSSSDSDSSDTSYSDSESGSSSSDSSSGSRETPQKRVRATDKALNERKLISKPAE
QSTKKRSPISIEIKKTSNMVGVSALASASNSADSDAEKDHDNGKDKEKDHVKEKDKDCKE
KDKDKDGMKDKEGKKSRREELLKQLRAVEDAIAKKRSKLN
Download sequence
Identical sequences Q9W3R9
FBpp0088653 FBpp0292476 NP_001284976.1.81976 NP_572387.1.81976 NP_727178.1.81976 7227.FBpp0088653 FBpp0088653 FBpp0088653 FBpp0292476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]