SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001285099.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001285099.1.81976
Domain Number 1 Region: 13-131
Classification Level Classification E-value
Superfamily L domain-like 4.76e-25
Family U2A'-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001285099.1.81976
Sequence length 365
Comment uncharacterized protein Dmel_CG15208, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEKQLTEHMVESMSRCRDYAKALKLNFCNCGLNDISLCLKMPYLEVLSLSMNKITSLKSL
VRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLDNPCSIAAGSNYRASVLRMLPNL
KKLDNVDVAEEELESALRYDYYPDVGSAILNPVLDLSNCSPDDMAYRDMIEQCDRTIRQV
QQQQRKRFASGDAKNIDELARIRSRSVLVNGERLPLFFPSDLRQVRQAQKAQDALRKQKN
QPIWHNEQVQQAHKFTMTPQAVHEQVQGIQSISSDRNADSPAASTSTLAENLIELINSRR
QDVVTPPGHLLPNVSSGLALNGANSTTLERHNNSLSAALLLIQDMNASQLETLVLAIIEQ
FVQLN
Download sequence
Identical sequences Q9VZ54
NP_001285099.1.81976 NP_001285100.1.81976 NP_572664.1.81976 FBpp0073239 FBpp0073239 FBpp0073239 7227.FBpp0073239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]