SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001285300.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001285300.1.81976
Domain Number 1 Region: 4-330
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 1.09e-147
Family Clathrin heavy-chain terminal domain 0.000000000107
Further Details:      
 
Domain Number 2 Region: 1184-1517
Classification Level Classification E-value
Superfamily ARM repeat 1.78e-114
Family Clathrin heavy chain proximal leg segment 0.0000000000579
Further Details:      
 
Domain Number 3 Region: 445-780
Classification Level Classification E-value
Superfamily ARM repeat 1.18e-97
Family Clathrin heavy-chain linker domain 0.00056
Further Details:      
 
Domain Number 4 Region: 332-488
Classification Level Classification E-value
Superfamily ARM repeat 1.78e-54
Family Clathrin heavy-chain linker domain 0.000000444
Further Details:      
 
Domain Number 5 Region: 888-1051
Classification Level Classification E-value
Superfamily ARM repeat 2.88e-35
Family Clathrin heavy-chain linker domain 0.023
Further Details:      
 
Domain Number 6 Region: 1038-1181
Classification Level Classification E-value
Superfamily ARM repeat 1.01e-28
Family Clathrin heavy chain proximal leg segment 0.0035
Further Details:      
 
Domain Number 7 Region: 804-889
Classification Level Classification E-value
Superfamily ARM repeat 0.00000558
Family Clathrin heavy chain proximal leg segment 0.028
Further Details:      
 
Weak hits

Sequence:  NP_001285300.1.81976
Domain Number - Region: 1539-1581
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0377
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001285300.1.81976
Sequence length 1678
Comment clathrin heavy chain, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDANKEPTTLFCFAVRTATGGKLHIIEVGAPPNGN
QPFAKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYVFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTNKALIDLFEGFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERYLKENQY
YDSRVVGRYCEKRDPHLACVAYERGLCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLENYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGNRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESCKQDIAEELLGWFLE
RDAYDCFAACLYQCYDLLRPDVILELAWKHKIVDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDSTEHKNIIQMEPQLMITAGPAMGIPPQYAQNYPPGAATVTAAGGRNMGYPYL
Download sequence
Identical sequences P29742 X2JC31
FBpp0073966 NP_001096993.1.81976 NP_001096994.1.81976 NP_001285300.1.81976 NP_477042.1.81976 NP_727901.1.81976 NP_996451.1.81976 NP_996452.1.81976 7227.FBpp0073967 FBpp0073966 FBpp0073967 FBpp0089397 FBpp0089398 FBpp0111709 FBpp0111710 7293138___KOG0985 FBpp0073966 FBpp0073967 FBpp0089397 FBpp0089398 FBpp0111709 FBpp0111710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]