SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001286106.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001286106.1.81976
Domain Number 1 Region: 269-364
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000213
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.048
Further Details:      
 
Weak hits

Sequence:  NP_001286106.1.81976
Domain Number - Region: 773-822
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0589
Family TF C-terminus 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001286106.1.81976
Sequence length 1252
Comment uncharacterized protein Dmel_CG31678, isoform E [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLLQFVMKFICCELNKLKTNLTMFLIFFWIIWFSQIIAISTVFMSFPEIITELPAVTITE
LPLDRVMNRLDSVILDGSPATAGNHSDEEQHQQQQQPHEDQPMQVSEADEEVPQKDEQMP
KINDPGGGIQVEGMVTPEAATVGETQESSEELQPGSAAFNGTEGTANLTNANEEVPMPVF
SEWAQKQMEAEASREQAMELEQQVVNKSAQRKNNTGSSSGKPPTLKLRSKNYASPDCGAK
IIAHNSESKHTEAVLTQSTDEYMLSTCESRIWFVVELCEAIQAQKVDVANYELFSSSPKN
FTVAVSKRFPTRDWSNVGRFAAEDKRTIQTFELHPHLFGKFVRVDITSHYANEHFCPLSL
FRVFGTSEYEAFETEIRPSDDLDDFYDDYGAQEQKAAVGSGGNIFQSASDAVMQMVKKAA
EVLVKPTKALKWSEESVLCQTPAFEAFSCINCNTTLVERINSLLSCQFQQLQALLSLSHL
RSDLLNSRVCQEEFGISLTGSEFASKMGKEQSYFLSMLPAEHVGAMCKLIQAEQNVTDHN
HTKAPSLKQHVSSPEPVQDNATATGVRQDCENSKTPTKEPLTPSLEVVVPEVSQEVPSME
DQSSTSSETVSTTNSTPADVNIFNMPSEPEEVVVKVQLPPEPTLPTTLQPSDVESFTDAP
STNALPGSSEAVANGDLGMEEGNPANWDGIDNLLTTTVASITAGGGAAAAAAAVVNGNAN
IGGAGIVGAGGPASLSSVNMQQKLTNGAQSESVFIRLSNRIKALERNMSLSGQYLEELSR
RYKKQVEELQQTLTQQTLTVRQLEDQSRRYVEQEQLYQQHSAELAGEVRALSYQVQACIL
VIIIVGTCIFLMLVLGTVYYRKLRRQQQQLLKKDQAGHPPVAAKPKLDRRKSYEQTPNQS
TPKQRRPSEEAMLILKECGDSNMQELDPPSRQRKISVCYGSNNNIAANMAIANTNGGASV
RNSLHRRKGAKHSWHNSLDTTETSCGEQTDKFFDVDTLKSIKQSCGKPGKKKSLQQLKPL
GLKRQESAPATYTPDLQAEEPATQSDFDESLMLDDDDLANFIPTSDLAYNEFMPEGPSGY
QIVDTVDGKPGKEPGTKKSRRLSSPAFFKSPFSKSKNKGYSFNGVKNSHAVHEPTSWEWY
RLKRSEKHQQQQQAKLVSKSLPSASLDSSSLSEVNFPLSSSTATTQNSFRILGEAILSSG
EGRITPNGNGNAMSGGLASSSSGSGSGGSTTSSTTKKKQRALNNLFRKAFDF
Download sequence
Identical sequences B7YZY0
NP_001137844.1.81976 NP_001286106.1.81976 FBpp0288499 FBpp0288499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]