SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001286246.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001286246.1.81976
Domain Number 1 Region: 242-375
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.05e-16
Family Toll/Interleukin receptor TIR domain 0.0058
Further Details:      
 
Domain Number 2 Region: 83-173
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000206
Family DEATH domain, DD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001286246.1.81976
Sequence length 537
Comment Myd88, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MRPRFVCHQQHSVAHSHYQPHSHFHHHTHRHPNPPHHHHIYGATDVSYRRYRTAGMVVAE
GVMDSGSGSGTGTGLGHFNETPLSALGIETRTQLSRMLNRKKVLRSEEGYQRDWRGISEL
AKQKGFVDENANNPMDLVLISWSQRSPQTAKVGHLEHFLGIIDRWDVCDDIQENLAKDTQ
RFIMKQEQRQTALVEACPPPPSDCFETNNNYSSSNNITVGQSVQILSDEDQRCVQMGQPL
PRYNACVLYAEADIDHATEIMNNLESERYNLRLFLRHRDMLMGVPFEHVQLSHFMATRCN
HLIVVLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPILYKTDMHIPQTLGIYTHIKYAG
DSKLFNFWDKLARSLHDLDAFSIYSTRQVQTPSPVEESAPRVTTPSIRIQINDKDVTDMP
NYNSCKVPEAETTIVSVSGDTGSPLPEHKPKKKDRFLRRITHSFGKTARSDGASGKTLRH
AHSVSTINVTERERTLSASSSNISTTSESKKSFIKWQPNILKKALFSRSSSKLQTPG
Download sequence
Identical sequences Q7K105
FBpp0087679 NP_001260821.1.81976 NP_001286246.1.81976 NP_610479.1.81976 7227.FBpp0087679 FBpp0087679 FBpp0305215 FBpp0087679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]