SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001286846.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001286846.1.81976
Domain Number 1 Region: 200-350
Classification Level Classification E-value
Superfamily HAD-like 3.96e-31
Family NLI interacting factor-like phosphatase 0.0096
Further Details:      
 
Domain Number 2 Region: 576-674
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000276
Family DNA-repair protein XRCC1 0.055
Further Details:      
 
Weak hits

Sequence:  NP_001286846.1.81976
Domain Number - Region: 55-143
Classification Level Classification E-value
Superfamily Single hybrid motif 0.000387
Family Biotinyl/lipoyl-carrier proteins and domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001286846.1.81976
Sequence length 880
Comment TFIIF-interacting CTD phosphatase, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MQNIPDEEGATPSRAPGGVAASGAAEGDDGGGGSGAKNSASGNSNNNTSGGGIIVLRAAL
GENEARAVINKWRVREGQFVSAAQILFLYQPVGVDAKDAKDAGKPGGDCAIQRYKSQRAG
VVKKRLRKEGELLTKGDAILELSECIHTTVIKDMCADCGADLRQNENGQTSEASVPMVHT
MPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHTTNDTVPDNIKGIYHFQLYG
PHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRD
ECFNATSKTDNLKALFPNGDSMVCIIDDREDVWNMASNLIQVKPYHFFQHTGDINAPPGL
SKHELDGEGVDFKEITEKHGDKDKTESSSEVKPEDTDKGDNTVTSTSKDDDVNEESVDVF
EIEGDAKDPEVSNASSATEAPKEPRDKLNGKTNAEDIVVIDDSSSGSPDAEKAASDGEDV
VVIDDNSKESTKAEVPPTPAEKNEVVASSTTSPDEKRPSADADVATTSKTPSLRAPLEGQ
KQIEIEDPDDYLLYLEVILRNIHKRFYSIYDETTEIPDLKVIVPKIRSEVLRGKNLVFSG
LVPTQMKLEQSRAYFIAKSLGAEVKPNIDKEITHLVAVNAGTYKVNAAKKEPAIKVVNAN
WLWTCAERWEHVEEKLFPLDRKVRNKGRQPPAHCHSPEHVVNYSERSEISPSSSKQQEEQ
SGNFRETLNPLLVFTNADIESMNKDYETFFESDSSSDEGPVNFENPPMDKKLLKRKREDD
NSNRAHDFFTRSDDIMIGAPNLVEVDISSNEEADDNNEKEDDDDEMPSAKFRRGEDLPSD
LELGSESNSEKEPEDEDDGEWNMMGAALEREFLGLEDFDM
Download sequence
Identical sequences Q9W147
FBpp0072249 FBpp0072249 FBpp0072249 NP_001286846.1.81976 NP_611934.1.81976 7227.FBpp0072249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]