SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001287333.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001287333.1.81976
Domain Number 1 Region: 8-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.8e-52
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 524-624
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000101
Family Ankyrin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  NP_001287333.1.81976
Domain Number - Region: 259-280,324-385
Classification Level Classification E-value
Superfamily TPR-like 0.000885
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001287333.1.81976
Sequence length 664
Comment CG6966, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDYKFIVFNAARDNNLAQLKATLYNKSSVEVGSLISAKVNGATPLVISCRNGHYDIVEYL
LTKCRANVEQVGSVSFDGEPIEDAPPLWCAAAAGHLGIVKMLVRRGANVNSTTRTNSTPL
RAACFDGHYEIVKYLVHHGADFEVANRHGHTCLMIACYKGHFRIAQYLLSLNADVNRCSV
KGNTALHDCAESGSLQILQLLLKHGATMDVDYYGMTPLLAASVTGHMPIVEHLITLPCVS
RESRIHALELLGATYVDRKRDMAAALNLWRRALEERAVEPPLEKKVQEPVPAYEMVREVT
SVEELEEMVLDPDEMRMQALVIRQRILGPTHPDTSYYIRFRGAHYADAGRFDRCIELWSY
ALTMQQKILQPLSPMTQSSLLSFAELFSFMLVEAGRLLPRGRVVPPIEPDSMLTIFYKAV
KEVERGLAFTLEQQKDQQHPQKQLPAADKSPSCSASSSASSSSSTTLLSAHQHDCNHDPN
ALSRTMISAIHIGCLLSSLLDTDALSPEMRRQVMGALYRLNRLKVRVRFDRTALHYACYR
EGTLAGRYPSCQFPSVTLAKALLEVGADPNAIDEAGNTPLHLATMQPYVEPLSHILLEGG
AHLDTKNYAGETFESLLAPTPMHKIIDPMKYTTLACLAARTIKKHDIRYEGTVPATLYEF
IELH
Download sequence
Identical sequences A0A0B4LI92 Q9VFD5
7227.FBpp0112148 NP_001097796.1.81976 NP_001287333.1.81976 FBpp0112148 FBpp0112148 FBpp0112148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]