SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001288030.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001288030.1.87134
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.09e-32
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001288030.1.87134
Sequence length 161
Comment phosphopantothenoylcysteine decarboxylase isoform b [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFY
SPQDIPVTLYSDADEWETCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVE
IPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
Download sequence
Identical sequences H3BQB0
ENSP00000455691 NP_001288030.1.87134 NP_001288030.1.92137 ENSP00000455691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]