SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001290211.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001290211.1.92137
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.3e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 407-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 222-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000745
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Weak hits

Sequence:  NP_001290211.1.92137
Domain Number - Region: 331-351
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0183
Family TTHA0281-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001290211.1.92137
Sequence length 548
Comment zinc finger protein 18 isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MPVDLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMSGPHETLK
QLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPQRLWQWISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQELGLENSSSGPGELLSH
IVKEESDTEAELALAASQPARLEERLIRDQDLGASLLPAAPQEQWRQLDSTQKEQYWDLM
LETYGKMVSGGISHPKSDLTNSIEFGEELAGIYLHVNEKIPRPTCIGDRQENDKENLNLE
NHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSP
QERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLPTCRECGKTFYRNS
QLIFHQRTHTGETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLRH
HEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSHCGKSFSWSSSLDKHQRS
HLGKKPFQ
Download sequence
Identical sequences ENSP00000391376 NP_001290211.1.87134 NP_001290211.1.92137 XP_016880497.1.92137 XP_016880498.1.92137 XP_016880499.1.92137 XP_016880500.1.92137 ENSP00000391376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]