SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001294330.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001294330.1.50509
Domain Number - Region: 323-376
Classification Level Classification E-value
Superfamily SH3-domain 0.000312
Family SH3-domain 0.0053
Further Details:      
 
Domain Number - Region: 60-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001294330.1.50509
Sequence length 438
Comment Uncharacterized protein CELE_F19C7.8 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MEFKVSSSQRCSSPPWFLHHHLTTTAGGASRPLPLHHRSHSASTPTTTSSITASPSLSQL
PPHQPYHLHQQQQHHQQLHKTMTSALEKCTSSLSEIHRLLRESSTSSYGTMSTNSSIESS
PIEQATSRSARRKWHSAMRFIQGVQRFKTPVMSHKRTTEIREQSVGRTSCESAIVDPVYL
ALKQATGRYSRRGSTTFESASPSPRNLSQVSLQDSGYVEMGSSKANPLLGSTPQLDNAGR
SVGRRRAPKLTQQMKSLSLDCQDMPPRINQNTRSPLISGSKLAPRDYRKPGINGSSDFSD
VERSCSPIVKSRRSSSSALHAGGYIVIHEYSPSNGSSLVLGEKVRVVDNGDPDWLHGFRL
NDRTEHMISFPATCVAQMMAGEQAMRIQQNVFVAEQKLRMYRDQIVFVQPESLVEGKVTV
RTEHNALAPCPLSYLALI
Download sequence
Identical sequences U4PLS7
F19C7.8e NP_001294330.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]