SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001297571.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001297571.1.92730
Domain Number 1 Region: 5-226
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.28e-62
Family D-ribulose-5-phosphate 3-epimerase 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001297571.1.92730
Sequence length 235
Comment ribulose-phosphate 3-epimerase isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDAPCSSGRSVFLHFVPNITFGHPV
VESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGM
KVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIE
VDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences B2KGF0
10090.ENSMUSP00000109628 NP_001297571.1.92730 ENSMUSP00000109628 ENSMUSP00000109628 ENSMUSP00000109628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]