SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001300658.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001300658.1.45394
Domain Number 1 Region: 112-126,277-515
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-66
Family Nuclear receptor ligand-binding domain 0.00000000532
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-30
Family Nuclear receptor 0.00014
Further Details:      
 
Weak hits

Sequence:  NP_001300658.1.45394
Domain Number - Region: 140-199
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.0399
Family TroA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001300658.1.45394
Sequence length 517
Comment nuclear receptor subfamily 5 group A member 2 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MLPKVESEYLGLARSHGEQGHMPGNMQAPQFKMMDYSYDEDLDEMCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQSCQIDKTQRKRCPYCRFQKCLTVGMKLEAVRADR
MRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMTQVMQTVPADLTITSAIQNIHSAS
KGLPLSHHHHHHHHHHHHSSSSAGLPPADFDRSPFVTSPVSMAMPPHAGGLQGYQAYGHF
QSRTIKSEYPDPYTSSPESLMGYPYVEAYAGGSPPSFPHLVVELLKCEPDEPQVQAKILA
YLQQEQASRGKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSE
LLILDHVFRQVMHAKEGSILLVTGQQVDYALIASQAGATLNNLLSHAQELVSKLRSLQLD
QREFVCLKFLVLFSLDVKNLENFHLVESVQEQVNAALLDYVMCNYPQQTDKFGQLLLRLP
EIRAISLQAEEYLYYKHLNGDVPCNNLLIEMLHAKRA
Download sequence
Identical sequences Q90YL6
ENSDARP00000106755 NP_001300658.1.45394 ENSDARP00000106755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]