SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001303867.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001303867.1.92137
Domain Number 1 Region: 16-262
Classification Level Classification E-value
Superfamily RNI-like 3.4e-18
Family Cyclin A/CDK2-associated p19, Skp2 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001303867.1.92137
Sequence length 273
Comment F-box/LRR-repeat protein 12 isoform c [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVAD
LSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLT
RFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKI
RLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLG
WEGQEAEKILCKGLPHCMVIVRACPKESMDWWM
Download sequence
Identical sequences A0A2J8LWT3
NP_001303866.1.87134 NP_001303866.1.92137 NP_001303867.1.87134 NP_001303867.1.92137 NP_001303868.1.87134 NP_001303868.1.92137 NP_001303869.1.87134 NP_001303869.1.92137 NP_001303870.1.87134 NP_001303870.1.92137 NP_001303871.1.87134 NP_001303871.1.92137 XP_003809655.1.60992 XP_004089368.1.23891 XP_007993385.1.81039 XP_008960118.1.60992 XP_008960119.1.60992 XP_008960120.1.60992 XP_009432927.1.37143 XP_009432928.1.37143 XP_009432929.1.37143 XP_011734771.1.29376 XP_012365036.1.23891 XP_012365038.1.23891 XP_012365039.1.23891 XP_012365040.1.23891 XP_012365041.1.23891 XP_512355.2.37143 ENSP00000467359 ENSP00000468369 ENSP00000467359 ENSP00000468369 HR1151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]