SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001304696.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001304696.1.45394
Domain Number 1 Region: 389-479
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.46e-19
Family PLC-like (P variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001304696.1.45394
Sequence length 555
Comment perforin 1.3 precursor [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MALLLLLFSLPFAFGCESVASTECEKLPFVPGHNLVGEGFNIVQMKTTGAFVVDVRNYMS
GGDHGNCTACDNKLLNQKQKLPVSVIDWRIKVQCRRSLSAKVYESASSVMEDTTSAASLS
WKVGLSVPMVAGVAVGGTHSKSARFARSHASKDKFSYTSHTFSCRYYSFRLHARPPLTKE
FAGSISSLPAKFDSTSESAYNHFISIYGTHFLRRVDLGGRVKSTTAVRTCQVSMKGLSAN
DVSNCLSAEASAIIKGVKVSGQTAYCKSKQKQLERANSFSATFSDRVTDILGGNGEQQDI
LFTPSNVSGYGKWLGSLKKIPGVVSYTLSSLHMLVRNDSARRSSLQQAISKYITKYAIST
ACPRNCKVGKRERNCACKCNGHVNVNSNCCPNKPGVATLTVTVVSAAGLWGDVFSKTDGY
VKVFYGSHTAQTPVIWNNNFPQWNFRAEFGTVDLTKKASLQFQVWDRDNGFDDDLLGKGA
VVPEKGVNVPKRFGFKHGSLMISYSATCGPSLQGSFCEIYAPTPGGDGVLNYYNPFGTER
PVFFKTDSKRDMSFL
Download sequence
Identical sequences F1R8E0
ENSDARP00000001478 NP_001304696.1.45394 ENSDARP00000001478 ENSDARP00000119684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]