SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001304703.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001304703.1.87134
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001304703.1.87134
Sequence length 212
Comment ropporin-1A isoform a [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVA
LCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHV
SRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE
Download sequence
Identical sequences A0A140VKB2 Q9HAT0
NP_001304703.1.87134 NP_001304703.1.92137 NP_060048.2.87134 NP_060048.2.92137 XP_011511235.1.92137 XP_011511236.1.92137 ENSP00000184183 ENSP00000385919 ENSP00000483603 ENSP00000184183 gi|21359920|ref|NP_060048.2| ENSP00000184183 ENSP00000385919 GO.101431 9606.ENSP00000184183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]