SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001307006.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001307006.1.92730
Domain Number 1 Region: 211-403
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.45e-60
Family Hemopexin-like domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.67e-57
Family Matrix metalloproteases, catalytic domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000353
Family MMP N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001307006.1.92730
Sequence length 403
Comment macrophage metalloelastase isoform 3 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMK
REDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFY
PGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPS
TFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFF
WWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPR
SIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIK
PKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC
Download sequence
Identical sequences Q3TCW6
ENSMUSP00000114129 NP_001307006.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]