SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001315462.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001315462.1.45394
Domain Number 1 Region: 529-874
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.91e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000558
Further Details:      
 
Domain Number 2 Region: 265-409,464-511
Classification Level Classification E-value
Superfamily ARM repeat 6.62e-64
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00029
Further Details:      
 
Domain Number 3 Region: 35-162
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.75e-39
Family PLC-like (P variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001315462.1.45394
Sequence length 878
Comment phosphatidylinositol 3-kinase catalytic subunit type 3 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLRFSGLYQESCSDLYVTC
QVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVTLTVWDVYGPGRATP
VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGTEPTSTPGRTSSSLAEDQMGRLAKLTKA
HRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFPRVKSGEREYSIVYYEKDAD
ESSPLPTSSDIVKVPDPQMCMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVS
YPPTKQLSSEEQDLVWKFRYYLTTQEKALTKFLKCVNWDLPQEAKQALELLGKWRPMDVE
DSLELLSSQFTNPTVRRYAVARLQQADDEDLLMYLLQLVQALKYENFNDIQGGLEPANKR
DNQGGLTESSTTGDLDSSQLASAIAVMPSSQKGKEGTDGENLEQDLCTFLISRACKNSTL
ANYLYWYVIVECEDQDTQQRDPKTHDMYLNVMRRFSQALLKGDKSVRVMRSLLASQQTFV
DRLVQLMKAVQRESGNRKKKTERLQSLLADNEKVNLSEIEPIPLPLEPQIRIKGIIPETA
TLFKSALMPAKLIFKTEDGEQYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTP
YKVLATSTKHGFMQFVQSVPVAEVLATEGNIQSFFRKYAPNDKGPYGISSEVMDTYVKSC
AGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLSKEMVEGMGG
MQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLD
LSDEEAVHYMQSLIDESVGALFAAVVEQIHKFAQYWRR
Download sequence
Identical sequences F1Q9F3
ENSDARP00000092039 ENSDARP00000092039 NP_001315462.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]