SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001317878.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001317878.1.50509
Domain Number 1 Region: 57-108
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 28-58
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000118
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001317878.1.50509
Sequence length 254
Comment Uncharacterized protein CELE_R17.3 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MPLKVTSTPLLYEENRVQPANNLYYLESSISECYCDEHCVTLGDCCSDYTFVCPPRDCVL
TDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTCFVECRPKKSALDD
ITTVALILDYRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNCVSRLLN
KGLSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTENCQ
CQIEYPKDHPFLLV
Download sequence
Identical sequences A0A1C3NSJ0
NP_001317878.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]