SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_002241.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002241.1.87134
Domain Number 1 Region: 287-375
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.64e-36
Family Small-conductance potassium channel 0.0000729
Further Details:      
 
Domain Number 2 Region: 189-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.81e-24
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_002241.1.87134
Sequence length 427
Comment intermediate conductance calcium-activated potassium channel protein 4 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Download sequence
Identical sequences O15554
ENSP00000262888 NP_002241.1.87134 NP_002241.1.92137 ENSP00000262888 gi|4504859|ref|NP_002241.1| 6cnm_A 6cnm_B 6cnm_C 6cnm_D 6cnn_A 6cnn_B 6cnn_C 6cnn_D 6cno_A 6cno_B 6cno_C 6cno_D 9606.ENSP00000262888 ENSP00000262888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]