SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_002267.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002267.2.92137
Domain Number 1 Region: 308-386
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-24
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 78-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000022
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 190-304
Classification Level Classification E-value
Superfamily Prefoldin 0.000000497
Family Prefoldin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_002267.2.92137
Sequence length 400
Comment keratin, type I cytoskeletal 19 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Download sequence
Identical sequences P08727
NP_002267.2.87134 NP_002267.2.92137 ENSP00000355124 gi|24234699|ref|NP_002267.2| NYSGXRC-13050a 9606.ENSP00000355124 ENSP00000355124 ENSP00000355124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]